PDB entry 2csn

View 2csn on RCSB PDB site
Description: binary complex of casein kinase-1 with cki7
Deposited on 1995-10-11, released 1996-03-08
The last revision prior to the SCOP 1.59 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.178
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d2csn__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2csn_ (-)
    nvvgvhykvgrrigegsfgvifegtnllnnqqvaikfeprrsdapqlrdeyrtykllagc
    tgipnvyyfgqeglhnvlvidllgpsledlldlcgrkfsvktvamaakqmlarvqsihek
    slvyrdikpdnfligrpnsknanmiyvvdfgmvkfyrdpvtkqhipyrekknlsgtarym
    sinthlgreqsrrddlealghvfmyflrgslpwqglkaatnkqkyerigekkqstplrel
    cagfpeefykymhyarnlafdatpdydylqglfskvlerlnttedenfdwnll