PDB entry 2csm

View 2csm on RCSB PDB site
Description: tyr-bound t-state of yeast chorismate mutase
Class: complex (isomerase/peptide)
Keywords: allosteric protein, complex (isomerase/peptide)
Deposited on 1995-11-24, released 1996-12-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.213
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chorismate mutase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2csma_
  • Heterogens: TYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2csmA (A:)
    mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
    dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
    yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
    kskdvegimknitnsaveekilerltkkaevygvdptnesgerritpeylvkiykeivip
    itkeveveyllrrlee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2csmA (A:)
    mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
    dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
    yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
    kskdvegimknitnsaveekilerltkkaevygvritpeylvkiykeivipitkevevey
    llrrl