PDB entry 2csj

View 2csj on RCSB PDB site
Description: Solution structure of N-terminal PDZ domain from mouse TJP2
Class: cell adhesion
Keywords: PDZ domain, TJP2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION
Deposited on 2005-05-21, released 2005-11-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tjp2 protein
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 4632401G08
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Z0U1 (7-110)
    • cloning artifact (0-6)
    • cloning artifact (111-116)
  Domains in SCOPe 2.01: d2csja1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2csjA (A:)
  gssgssgmeeviweqytvtlqkdskrgfgiavsggrdnphfengetsivisdvlpggpad
  gllqendrvvmvngtpmedvlhsfavqqlrksgkiaaivvkrprkvqvaplsgpssg