PDB entry 2csj

View 2csj on RCSB PDB site
Description: Solution structure of N-terminal PDZ domain from mouse TJP2
Class: cell adhesion
Keywords: PDZ domain, TJP2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION
Deposited on 2005-05-21, released 2005-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tjp2 protein
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 4632401G08
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Z0U1 (7-110)
      • cloning artifact (0-6)
      • cloning artifact (111-116)
    Domains in SCOPe 2.07: d2csja1, d2csja2, d2csja3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2csjA (A:)
    gssgssgmeeviweqytvtlqkdskrgfgiavsggrdnphfengetsivisdvlpggpad
    gllqendrvvmvngtpmedvlhsfavqqlrksgkiaaivvkrprkvqvaplsgpssg