PDB entry 2csh

View 2csh on RCSB PDB site
Description: Solution structure of tandem repeat of the zf-C2H2 domains of human zinc finger protein 297B
Class: transcription
Keywords: zf-C2H2 domain, Zinc finger protein 297B, Zinc finger and BTB domain containing protein 22B, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2005-05-21, released 2005-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein 297B
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA hh00161
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43298 (7-103)
      • cloning artifact (0-6)
      • cloning artifact (104-109)
    Domains in SCOPe 2.07: d2csha1, d2csha2, d2csha3, d2csha4
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cshA (A:)
gssgssgdklypcqcgksfthksqrdrhmsmhlglrpygcgvcgkkfkmkhhlvghmkih
tgikpyecnicakrfmwrdsfhrhvtsctksyeaakaeqntteasgpssg