PDB entry 2csg

View 2csg on RCSB PDB site
Description: Crystal Structure of the Putative Oxidoreductase from Salmonella typhimurium LT2
Class: Oxidoreductase
Keywords: OXIDOREDUCTASE, PENICILLIN, MONONUCLEAR FERROUS ENZYMES, ANTIBIOTIC BIOSYNTHESIS, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-05-21, released 2005-07-05
The last revision prior to the SCOP 1.73 freeze date was dated 2005-07-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.193
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytoplasmic protein
    Species: Salmonella typhimurium LT2
    Gene: ybiU
    Database cross-references and differences (RAF-indexed):
    • GB AAL19777
    Domains in SCOP 1.73: d2csga1
  • Heterogens: FE, ICT, SIN, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2csgA (A:)
    snamttpfthetlpadpkaairqmkqalraqigdvqavfdrlsatiaarvaeindlkaqg
    qpvwpiipfselamgnisdatraevkrrgcavikghfpreqalawdqsmldyldknhfde
    vykgpgdnffgtlsasrpeiypvywsqaqmqarqseemalaqsflnrlwqvehdgkrwfn
    pdisiiypdrirrrppgttskglgahtdsgalerwllpayqqvfasvfngnveqydpwna
    ahrtdveeytvdnttkcsvfrtfqgwtalsdmlpgqgllhvvpipeamayillrpllddv
    pedelcgvapgrvlpiseqwhpllmaaltsippleagdsvwwhcdvihsvapvenqqgwg
    nvmyipaapmceknlayarkvkaaletgaspgdfpredyettwegrftlrdlnihgkral
    gidv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2csgA (A:)
    tpfthetlpadpkaairqmkqalraqigdvqavfdrlsatiaarvaeindlkaqgqpvwp
    iipfselamgnisdatraevkrrgcavikghfpreqalawdqsmldyldknhfdevykgp
    gdnffgtlsasrpeiypvywsqaqmqarqseemalaqsflnrlwqvehdgkrwfnpdisi
    iypdrirrrppgttskglgahtdsgalerwllpayqqvfasvfngnveqydpwnaahrtd
    veeytvdnttkcsvfrtfqgwtalsdmlpgqgllhvvpipeamayillrpllddvpedel
    cgvapgrvlpiseqwhpllmaaltsippleagdsvwwhcdvihsvapvenqqgwgnvmyi
    paapmceknlayarkvkaaletgaspgdfpredyettwegrftlrdlnihgkralgi