PDB entry 2csf

View 2csf on RCSB PDB site
Description: Solution structure of the second CUT domain of human SATB2
Class: transcription
Keywords: CUT domain, DNA-binding protein SATB2, Special AT-rich sequence-binding protein 2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2005-05-21, released 2005-11-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding protein SATB2
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA fh00753
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UPW6 (7-94)
      • cloning artifact (0-6)
      • cloning artifact (95-100)
    Domains in SCOPe 2.06: d2csfa1, d2csfa2, d2csfa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2csfA (A:)
gssgssgpikvdganinitaaiydeiqqemkrakvsqalfakvaanksqgwlcellrwke
npspenrtlwenlctirrflnlpqherdviyeeessgpssg