PDB entry 2csd

View 2csd on RCSB PDB site
Description: Crystal structure of Topoisomerase V (61 kDa fragment)
Class: isomerase
Keywords: topoisomerase IB, topoisomerase V, helix-turn-helix, helix-hairpin-helix, HhH motif, three helix bundle, ISOMERASE
Deposited on 2005-05-21, released 2006-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2csdA (A:)
    malvydaefvgserefeeeretflkgvkaydgvlatrylmersssakndeellelhqnfi
    lltgsyacsidptedryqnvivrgvnfdervqrlstggsparyaivyrrgwraiakaldi
    deedvpaievravkrnplqpalyrilvrygrvdlmpvtvdevppemageferlierydvp
    idekeerileilrenpwtphdeiarrlglsvsevegekdpessgiyslwsrvvvnieyde
    rtakrhvkrrdrlleelyehleelserylrhpltrrwivehkrdimrryleqrivecalk
    lqdrygiredvalclarafdgsismiattpyrtlkdvcpdltleeaksvnrtlatlideh
    glspdaadeliehfesiagilatdleeiermyeegrlseeayraaveiqlaeltkkegvg
    rktaerllrafgnpervkqlarefeieklasvegvgervlrslvpgyaslisirgidrer
    aerllkkyggyskvreagveelredgltdaqirelkglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2csdA (A:)
    lvydaefvgserefeeeretflkgvkaydgvlatrylmersssakndeellelhqnfill
    tgsyacsidptedryqnvivrgvnfdervqrlstggsparyaivyrrgwraiakaldide
    edvpaievravkrnplqpalyrilvrygrvdlmpvtvdevppemageferlierydvpid
    ekeerileilrenpwtphdeiarrlglsvsevegekdpessgiyslwsrvvvnieydert
    akrhvkrrdrlleelyehleelserylrhpltrrwivehkrdimrryleqrivecalklq
    drygiredvalclarafdgsismiattpyrtlkdvcpdltleeaksvnrtlatlidehgl
    spdaadeliehfesiagilatdleeiermyeegrlseeayraaveiqlaeltkkegvgrk
    taerllrafgnpervkqlarefeieklasvegvgervlrslvpgyaslisirgidrerae
    rllkkyggyskvreagveelredgltdaqirelkgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2csdB (B:)
    malvydaefvgserefeeeretflkgvkaydgvlatrylmersssakndeellelhqnfi
    lltgsyacsidptedryqnvivrgvnfdervqrlstggsparyaivyrrgwraiakaldi
    deedvpaievravkrnplqpalyrilvrygrvdlmpvtvdevppemageferlierydvp
    idekeerileilrenpwtphdeiarrlglsvsevegekdpessgiyslwsrvvvnieyde
    rtakrhvkrrdrlleelyehleelserylrhpltrrwivehkrdimrryleqrivecalk
    lqdrygiredvalclarafdgsismiattpyrtlkdvcpdltleeaksvnrtlatlideh
    glspdaadeliehfesiagilatdleeiermyeegrlseeayraaveiqlaeltkkegvg
    rktaerllrafgnpervkqlarefeieklasvegvgervlrslvpgyaslisirgidrer
    aerllkkyggyskvreagveelredgltdaqirelkglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2csdB (B:)
    lvydaefvgserefeeeretflkgvkaydgvlatrylmersssakndeellelhqnfill
    tgsyacsidptedryqnvivrgvnfdervqrlstggsparyaivyrrgwraiakaldide
    edvpaievravkrnplqpalyrilvrygrvdlmpvtvdevppemageferlierydvpid
    ekeerileilrenpwtphdeiarrlglsvsevegekdpessgiyslwsrvvvnieydert
    akrhvkrrdrlleelyehleelserylrhpltrrwivehkrdimrryleqrivecalklq
    drygiredvalclarafdgsismiattpyrtlkdvcpdltleeaksvnrtlatlidehgl
    spdaadeliehfesiagilatdleeiermyeegrlseeayraaveiqlaeltkkegvgrk
    taerllrafgnpervkqlarefeieklasvegvgervlrslvpgyaslisirgidrerae
    rllkkyggyskvreagveelredgltdaqirelkgl