PDB entry 2csb

View 2csb on RCSB PDB site
Description: Crystal structure of Topoisomerase V from Methanopyrus kandleri (61 kDa fragment)
Class: isomerase
Keywords: topoisomerase IB, topoisomerase V, helix-turn-helix, helix-hairpin-helix, HhH motif, three helix bundle, Methanopyrus kandleri
Deposited on 2005-05-21, released 2006-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 2006-02-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.22
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Topoisomerase V
    Species: Methanopyrus kandleri
    Database cross-references and differences (RAF-indexed):
    • GB NP_614719 (Start-518)
      • modified residue (39)
      • modified residue (154)
      • modified residue (165)
      • modified residue (285)
      • modified residue (324)
      • modified residue (390)
    Domains in SCOP 1.73: d2csba1, d2csba2, d2csba3, d2csba4, d2csba5
  • Chain 'B':
    Compound: Topoisomerase V
    Species: Methanopyrus kandleri
    Database cross-references and differences (RAF-indexed):
    • GB NP_614719 (Start-518)
      • modified residue (39)
      • modified residue (154)
      • modified residue (165)
      • modified residue (285)
      • modified residue (324)
      • modified residue (390)
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2csbA (A:)
    malvydaefvgserefeeeretflkgvkaydgvlatrylmersssakndeellelhqnfi
    lltgsyacsidptedryqnvivrgvnfdervqrlstggsparyaivyrrgwraiakaldi
    deedvpaievravkrnplqpalyrilvrygrvdlmpvtvdevppemageferlierydvp
    idekeerileilrenpwtphdeiarrlglsvsevegekdpessgiyslwsrvvvnieyde
    rtakrhvkrrdrlleelyehleelserylrhpltrrwivehkrdimrryleqrivecalk
    lqdrygiredvalclarafdgsismiattpyrtlkdvcpdltleeaksvnrtlatlideh
    glspdaadeliehfesiagilatdleeiermyeegrlseeayraaveiqlaeltkkegvg
    rktaerllrafgnpervkqlarefeieklasvegvgervlrslvpgyaslisirgidrer
    aerllkkyggyskvreagveelredgltdaqirelkglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2csbA (A:)
    lvydaefvgserefeeeretflkgvkaydgvlatrylmersssakndeellelhqnfill
    tgsyacsidptedryqnvivrgvnfdervqrlstggsparyaivyrrgwraiakaldide
    edvpaievravkrnplqpalyrilvrygrvdlmpvtvdevppemageferlierydvpid
    ekeerileilrenpwtphdeiarrlglsvsevegekdpessgiyslwsrvvvnieydert
    akrhvkrrdrlleelyehleelserylrhpltrrwivehkrdimrryleqrivecalklq
    drygiredvalclarafdgsismiattpyrtlkdvcpdltleeaksvnrtlatlidehgl
    spdaadeliehfesiagilatdleeiermyeegrlseeayraaveiqlaeltkkegvgrk
    taerllrafgnpervkqlarefeieklasvegvgervlrslvpgyaslisirgidrerae
    rllkkyggyskvreagveelredgltdaqirelkglk
    

  • Chain 'B':
    No sequence available.