PDB entry 2cs5

View 2cs5 on RCSB PDB site
Description: Solution structure of PDZ domain of Protein tyrosine phosphatase, non-receptor type 4
Class: hydroalase
Keywords: PDZ domain, PTPase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROALASE
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase, non-receptor type 4
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29074 (7-112)
      • cloning artifact (0-6)
      • cloning artifact (113-118)
    Domains in SCOPe 2.08: d2cs5a1, d2cs5a2, d2cs5a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cs5A (A:)
    gssgssgnggiphdnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcvpr
    lnegdqvvlingrdiaehthdqvvlfikascerhsgelmllvrpnavydvveesgpssg