PDB entry 2cs4

View 2cs4 on RCSB PDB site
Description: Solution structure of N-terminal domain of chromosome 12 open reading frame 2
Class: structural genomics, signaling protein
Keywords: GTP binding, ubiquitin fold, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein C12orf2
    Species: Homo sapiens [TaxId:9606]
    Gene: C12orf2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NHQ8 (7-88)
      • cloning artifact (0-6)
      • cloning artifact (89-94)
    Domains in SCOPe 2.06: d2cs4a1, d2cs4a2, d2cs4a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cs4A (A:)
gssgssgmelkvwvdgvqrivcgvtevttcqevvialaqaigrtgrytliekwrdterhl
aphenpiislnkwgqyasdvqlilrrtgpsgpssg