PDB entry 2cs0

View 2cs0 on RCSB PDB site
Description: Solution structure of the SH2 domain of human HSH2D protein
Class: signaling protein
Keywords: ALX, FLJ14886, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hematopoietic SH2 domain containing
    Species: Homo sapiens [TaxId:9606]
    Gene: HSH2D
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96JZ2 (7-112)
      • cloning artifact (0-6)
      • cloning artifact (113-118)
    Domains in SCOPe 2.07: d2cs0a1, d2cs0a2, d2cs0a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cs0A (A:)
    gssgssggqlaqdgvpewfhgaisredaenllesqplgsflirvshshvgytlsykaqss
    cchfmvkllddgtfmipgekvahtsldalvtfhqqkpieprrelltqpcrqkdsgpssg