PDB entry 2cru

View 2cru on RCSB PDB site
Description: Solution structure of programmed cell death 5
Class: apoptosis
Keywords: three helix bundle, apoptosis, DNA binding, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-20, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Programmed cell death protein 5
    Species: HOMO SAPIENS
    Gene: PDCD5, TFAR19
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14737 (7-111)
      • cloning artifact (0-6)
      • cloning artifact (112-117)
    Domains in SCOP 1.73: d2crua1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cruA (A:)
    gssgssglrrqrlaelqakhgdpgdaaqqeakhreaemrnsilaqvldqsararlsnlal
    vkpektkavenyliqmarygqlsekvseqglieilkkvsqqtektttvkfnrsgpssg