PDB entry 2crn

View 2crn on RCSB PDB site
Description: Solution structure of the UBA domain of human UBASH3A protein
Class: immune system
Keywords: compact three-helix bundle, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOP 1.75 freeze date was dated 2005-11-20, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UBASH3A protein
    Species: HOMO SAPIENS
    Gene: UBASH3A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P57075 (7-57)
      • cloning artifact (0-6)
      • cloning artifact (58-63)
    Domains in SCOP 1.75: d2crna1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2crnA (A:)
    gssgssgsspsllepllamgfpvhtalkalaatgrktaeealawlhdhcndpslddpisg
    pssg