PDB entry 2crm

View 2crm on RCSB PDB site
Description: Solution structure of the forth FNIII domain of human
Class: cell adhesion
Keywords: FIBRONECTIN TYPE III DOMAIN, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibronectin type-III domain containing protein 3a
    Species: Homo sapiens [TaxId:9606]
    Gene: FNDC3, KIAA0970
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y2H6 (7-113)
      • cloning artifact (0-6)
      • cloning artifact (114-119)
    Domains in SCOPe 2.08: d2crma1, d2crma2, d2crma3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2crmA (A:)
gssgssgvvefttcpdkpgipvkpsvkgkihshsfkitwdppkdnggatinkyvvemaeg
sngnkwemiysgatrehlcdrlnpgcfyrlrvycisdggqsavsesllvqtpavsgpssg