PDB entry 2crj

View 2crj on RCSB PDB site
Description: Solution structure of the HMG domain of mouse HMG domain protein HMGX2
Class: gene regulation
Keywords: Structural DNA-binding protein BRAF35, DNA-BENDING, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related
    Species: Mus musculus [TaxId:10090]
    Gene: Hmg20b, Braf35, Hmgx2, Smarce1r
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Z104 (7-85)
      • cloning artifact (0-6)
      • cloning artifact (86-91)
    Domains in SCOPe 2.08: d2crja1, d2crja2, d2crja3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2crjA (A:)
gssgssgpkapvtgyvrflnerreqirtrhpdlpfpeitkmlgaewsklqpaekqrylde
aekekqqylkelwayqqseaykvctesgpssg