PDB entry 2cri

View 2cri on RCSB PDB site
Description: Solution structure of the MSP domain of mouse VAMP-associated proteinA
Class: transport protein
Keywords: VAP-A, VAP-33, beta sandwitch fold, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSPORT PROTEIN
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vesicle-associated membrane protein-associated protein A
    Species: Mus musculus [TaxId:10090]
    Gene: Vapa, Vap33
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WV55 (7-140)
      • cloning artifact (0-6)
      • cloning artifact (141-146)
    Domains in SCOPe 2.06: d2cria1, d2cria2, d2cria3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2criA (A:)
    gssgssgmakheqilvldppsdlkfkgpftdvvttnlklqnpsdrkvcfkvkttaprryc
    vrpnsgiidpgsivtvsvmlqpfdydpnekskhkfmvqtifappnisdmeavwkeakpde
    lmdsklrcvfempnendklndsgpssg