PDB entry 2crh

View 2crh on RCSB PDB site
Description: Solution structure of the SH2 domain of human proto-oncogene protein VAV1
Class: signaling protein
Keywords: ONCOPROTEIN, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vav proto-oncogene
    Species: Homo sapiens [TaxId:9606]
    Gene: VAV1, VAV
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15498 (7-131)
      • cloning artifact (0-6)
      • cloning artifact (132-137)
    Domains in SCOPe 2.07: d2crha1, d2crha2, d2crha3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2crhA (A:)
    gssgssgkaeaeqnwwegppqdlsvhlwyagpmeragaesilanrsdgtflvrqrvkdaa
    efaisikynvevkhikimtaeglyritekkafrgltelvefyqqnslkdcfksldttlqf
    pfkepekrtisrsgpssg