PDB entry 2crg

View 2crg on RCSB PDB site
Description: Solution structure of the myb-like DNA-binding domain of mouse MTA3 protein
Class: gene regulation
Keywords: transcription factor, helix turn helix, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Metastasis associated protein MTA3
  Species: Mus musculus [TaxId:10090]
  Gene: Mta3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q924K8 (7-63)
    • cloning artifact (0-6)
    • cloning artifact (64-69)
  Domains in SCOPe 2.06: d2crga1, d2crga2, d2crga3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2crgA (A:)
  gssgssgmeewsaseaclfeealekygkdfndirqdflpwksltsiieyyymwkttdryv
  qqkrsgpssg