PDB entry 2crf

View 2crf on RCSB PDB site
Description: Solution structure of the Ran_BP1 domain of RAN-binding protein-3
Class: transport protein
Keywords: Ran_BP1 domain, Ran-binding protein 3, RanBP3, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSPORT PROTEIN
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RAN binding protein 3
  Species: Homo sapiens [TaxId:9606]
  Gene: RANBP3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9H6Z4 (7-143)
    • cloning artifact (0-6)
    • cloning artifact (144-149)
  Domains in SCOPe 2.07: d2crfa1, d2crfa2, d2crfa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2crfA (A:)
  gssgssgtarkcllekvevitgeeaesnvlqmqcklfvfdktsqswvergrgllrlndma
  stddgtlqsrlvmrtqgslrlilntklwaqmqidkaseksihitamdtedqgvkvflisa
  sskdtgqlyaalhhrilalrsrvesgpssg