PDB entry 2crf

View 2crf on RCSB PDB site
Description: Solution structure of the Ran_BP1 domain of RAN-binding protein-3
Class: transport protein
Keywords: Ran_BP1 domain, Ran-binding protein 3, RanBP3, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-20, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RAN binding protein 3
  Species: HOMO SAPIENS
  Gene: RANBP3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9H6Z4 (7-143)
    • cloning artifact (0-6)
    • cloning artifact (144-149)
  Domains in SCOP 1.73: d2crfa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2crfA (A:)
  gssgssgtarkcllekvevitgeeaesnvlqmqcklfvfdktsqswvergrgllrlndma
  stddgtlqsrlvmrtqgslrlilntklwaqmqidkaseksihitamdtedqgvkvflisa
  sskdtgqlyaalhhrilalrsrvesgpssg