PDB entry 2cre

View 2cre on RCSB PDB site
Description: Solution structure of RSGI RUH-036, an SH3 domain from human cDNA
Class: structural genomics, unknown function
Keywords: SH3 domain, Src homology 3 domain, Beta barrel, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HEF-like protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NQ75 (7-64)
      • cloning artifact (0-6)
      • cloning artifact (65-70)
    Domains in SCOPe 2.05: d2crea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2creA (A:)
gssgssgllaralydncpdcsdelafsrgdiltileqhvpesegwwkcllhgrqglapan
rlqilsgpssg