PDB entry 2crb

View 2crb on RCSB PDB site
Description: Solution structure of MIT domain from mouse NRBF-2
Class: transcription
Keywords: NRBF-2, MIT domain, helix bundle, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-20, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nuclear receptor binding factor 2
  Species: MUS MUSCULUS
  Gene: RIKEN cDNA 1110048E14
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9DCG3 (7-90)
    • cloning artifact (0-6)
    • engineered (90)
    • cloning artifact (91-96)
  Domains in SCOP 1.73: d2crba1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2crbA (A:)
  gssgssgmegplnlahqqsrradrllaagkyeeaischrkattylseamklteseqahls
  lelqrdshmkqllliqerwkrakreerlkahsgpssg