PDB entry 2crb

View 2crb on RCSB PDB site
Description: Solution structure of MIT domain from mouse NRBF-2
Class: transcription
Keywords: NRBF-2, MIT domain, helix bundle, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nuclear receptor binding factor 2
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1110048E14
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9DCG3 (7-90)
      • cloning artifact (0-6)
      • engineered (90)
      • cloning artifact (91-96)
    Domains in SCOPe 2.08: d2crba1, d2crba2, d2crba3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2crbA (A:)
gssgssgmegplnlahqqsrradrllaagkyeeaischrkattylseamklteseqahls
lelqrdshmkqllliqerwkrakreerlkahsgpssg