PDB entry 2cra

View 2cra on RCSB PDB site
Description: Solution structure of the homeobox domain of human homeo box B13
Class: gene regulation
Keywords: DNA-binding, Transcription regulation, helix-turn-helix, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox protein Hox-B13
    Species: Homo sapiens [TaxId:9606]
    Gene: HOXB13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92826 (7-63)
      • cloning artifact (0-6)
      • cloning artifact (64-69)
    Domains in SCOPe 2.08: d2craa1, d2craa2, d2craa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2craA (A:)
    gssgssgrkkripyskgqlrelereyaankfitkdkrrkisaatslserqitiwfqnrrv
    kekksgpssg