PDB entry 2cr9

View 2cr9 on RCSB PDB site
Description: Solution structure of WGR domain of poly(ADP-ribose) polymerase-1
Class: Transferase
Keywords: parp, DNA repair, necrosis, apoptosis, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-20, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase-1
    Species: HOMO SAPIENS
    Gene: PARP1, ADPRT, PPOL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09874 (7-132)
      • cloning artifact (0-6)
      • cloning artifact (133-138)
    Domains in SCOP 1.73: d2cr9a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cr9A (A:)
    gssgssgksekrmkltlkggaavdpdsglehsahvlekggkvfsatlglvdivkgtnsyy
    klqlleddkenrywifrswgrvgtvigsnkleqmpskedaiehfmklyeektgnawhskn
    ftkypkkfypleisgpssg