PDB entry 2cr8

View 2cr8 on RCSB PDB site
Description: Solution structure of the zf-RanBP domain of p53-binding protein Mdm4
Class: cell cycle
Keywords: zf-RanBP domain; Mdm4 protein; p53-binding protein Mdm4; Mdm2-like p53-binding DE protein; Mdmx protein; Double minute 4 protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL CYCLE
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mdm4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM4
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15151 (7-46)
      • cloning artifact (0-6)
      • cloning artifact (47-52)
    Domains in SCOPe 2.08: d2cr8a1, d2cr8a2, d2cr8a3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cr8A (A:)
    gssgssgsedewqcteckkfnspskrycfrcwalrkdwysdcsklthsgpssg