PDB entry 2cr6

View 2cr6 on RCSB PDB site
Description: Solution structure of the Ig domain (2998-3100) of human obscurin
Class: contractile protein
Keywords: IG-fold, KIAA1556 protein, Immunoglobulin domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CONTRACTILE PROTEIN
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA1556 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA1556
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HCL6 (7-108)
      • cloning artifact (0-6)
      • cloning artifact (109-114)
    Domains in SCOPe 2.06: d2cr6a1, d2cr6a2, d2cr6a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cr6A (A:)
    gssgssglvqgrrvhiiedledvdvqegssatfrcrispanyepvhwfldktplhaneln
    eidaqpggyhvltlrqlalkdsgtiyfeagdqrasaalrvtekpsvfsrsgpssg