PDB entry 2cr2

View 2cr2 on RCSB PDB site
Description: Solution structure of N-terminal domain of speckle-type POZ protein
Class: immune system
Keywords: math domain, beta sandwich, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, IMMUNE SYSTEM
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Speckle-type POZ protein
  Species: Homo sapiens [TaxId:9606]
  Gene: SPOP
  Database cross-references and differences (RAF-indexed):
  • Uniprot O43791 (7-152)
    • cloning artifact (0-6)
    • cloning artifact (153-158)
  Domains in SCOPe 2.06: d2cr2a1, d2cr2a2, d2cr2a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cr2A (A:)
  gssgssgkvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldees
  kdylslylllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrd
  flldeangllpddkltlfcevsvvqdsvnisgqsgpssg