PDB entry 2cr0

View 2cr0 on RCSB PDB site
Description: Solution structure of nuclear move domain of nuclear distribution gene C
Class: transport protein
Keywords: CS domain, beta sandwich, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSPORT PROTEIN
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear migration protein nudC
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2700033I24
    Database cross-references and differences (RAF-indexed):
    • Uniprot O35685 (7-114)
      • cloning artifact (0-6)
      • cloning artifact (115-120)
    Domains in SCOPe 2.08: d2cr0a1, d2cr0a2, d2cr0a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cr0A (A:)
    gssgssgkpnlgngadlpnyrwtqtlaeldlavpfrvsfrlkgkdvvvdiqrrhlrvglk
    gqppvvdgelynevkveesswliedgkvvtvhlekinkmewwnrlvtsdpeintksgpss
    g