PDB entry 2cqx

View 2cqx on RCSB PDB site
Description: Solution structure of RSGI RUH-034, a homeodomain from mouse cDNA
Class: structural genomics, unknown function
Keywords: Homeodomain, DNA binding domain, Transcription, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: LAG1 longevity assurance homolog 5
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9D6K9 (7-65)
    • cloning artifact (0-6)
    • cloning artifact (66-71)
  Domains in SCOPe 2.07: d2cqxa1, d2cqxa2, d2cqxa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cqxA (A:)
  gssgssggikdspvnkvepndtlekvfvsvtkypdekrlkglskqldwsvrkiqcwfrhr
  rnqdkpsgpssg