PDB entry 2cqv

View 2cqv on RCSB PDB site
Description: Solution structure of the eighth Ig-like domain of human myosin light chain kinase
Class: contractile protein
Keywords: Ig fold, MLCK, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CONTRACTILE PROTEIN
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin light chain kinase, smooth muscle and non-muscle isozymes
    Species: Homo sapiens [TaxId:9606]
    Gene: MYLK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15746 (7-107)
      • cloning artifact (0-6)
      • cloning artifact (108-113)
    Domains in SCOPe 2.06: d2cqva1, d2cqva2, d2cqva3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cqvA (A:)
    gssgssgpqiiqfpedqkvragesvelfgkvtgtqpitctwmkfrkqiqesehmkvense
    ngskltilaarqehcgcytllvenklgsrqaqvnltvvdkpdppagtpsgpssg