PDB entry 2cqr

View 2cqr on RCSB PDB site
Description: Solution structure of RSGI RUH-043, a myb DNA-binding domain in human cDNA
Class: membrane protein
Keywords: MEMBRANE PROTEIN, STRUCTURAL GENOMICS, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DnaJ homolog subfamily C member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: AY225122
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96KC8 (7-66)
      • cloning artifact (0-6)
      • see remark 999 (42)
      • cloning artifact (67-72)
    Domains in SCOPe 2.07: d2cqra1, d2cqra2, d2cqra3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cqrA (A:)
    gssgssgslrkerarsaeepwtqnqqkllelalqqyprgssdcwdkiarcvpskskedci
    arykllvsgpssg