PDB entry 2cqq

View 2cqq on RCSB PDB site
Description: Solution Structure of RSGI RUH-037, a myb DNA-binding domain in human cDNA
Class: membrane protein
Keywords: MEMBRANE PROTEIN, STRUCTURAL GENOMICS, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DnaJ homolog subfamily C member 1
  Species: Homo sapiens [TaxId:9606]
  Gene: AY225122
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96KC8 (7-65)
    • cloning artifact (0-6)
    • cloning artifact (66-71)
  Domains in SCOPe 2.07: d2cqqa1, d2cqqa2, d2cqqa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cqqA (A:)
  gssgssgapewteedlsqltrsmvkfpggtpgrwekiahelgrsvtdvttkakqlkdsvt
  cspgmvsgpssg