PDB entry 2cqp

View 2cqp on RCSB PDB site
Description: Solution structure of the RNA binding domain of RNA-binding protein 12
Class: RNA binding protein
Keywords: RNA recognition motif, RRM, RNA binding domain, RBD, RNP, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein 12
    Species: Mus musculus [TaxId:10090]
    Gene: RBM12
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8R4X3 (7-91)
      • cloning artifact (0-6)
      • cloning artifact (92-97)
    Domains in SCOPe 2.02: d2cqpa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cqpA (A:)
gssgssgassgkpgptiikvqnmpftvsideildffygyqvipgsvclkynekgmptgea
mvafesrdeataavidlndrpigsrkvklvlgsgpssg