PDB entry 2cqp

View 2cqp on RCSB PDB site
Description: Solution structure of the RNA binding domain of RNA-binding protein 12
Class: RNA binding protein
Keywords: RNA recognition motif, RRM, RNA binding domain, RBD, RNP, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-20, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RNA-binding protein 12
  Species: MUS MUSCULUS
  Gene: RBM12
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8R4X3 (7-91)
    • cloning artifact (0-6)
    • cloning artifact (92-97)
  Domains in SCOP 1.73: d2cqpa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cqpA (A:)
  gssgssgassgkpgptiikvqnmpftvsideildffygyqvipgsvclkynekgmptgea
  mvafesrdeataavidlndrpigsrkvklvlgsgpssg