PDB entry 2cqn

View 2cqn on RCSB PDB site
Description: Solution structure of the FF domain of human Formin-binding protein 3
Class: transcription
Keywords: FF domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Formin-binding protein 3
  Species: Homo sapiens [TaxId:9606]
  Gene: FNBP3
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75400 (7-70)
    • cloning artifact (0-6)
    • cloning artifact (71-76)
  Domains in SCOPe 2.08: d2cqna1, d2cqna2, d2cqna3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cqnA (A:)
  gssgssgmkrkesafksmlkqaappieldavwedirerfvkepafeditleserkrifkd
  fmhvlehecqhsgpssg