PDB entry 2cqk

View 2cqk on RCSB PDB site
Description: Solution structure of the La domain of c-Mpl binding protein
Class: RNA binding protein
Keywords: La domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-Mpl binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: RIKEN cDNA IOH13489
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71RC2 (7-94)
      • cloning artifact (0-6)
      • cloning artifact (95-100)
    Domains in SCOPe 2.06: d2cqka1, d2cqka2, d2cqka3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cqkA (A:)
gssgssgavstedlkeclkkqlefcfsrenlskdlylisqmdsdqfipiwtvanmeeikk
lttdpdlilevlrsspmvqvdekgekvrpshkrcisgpssg