PDB entry 2cqg

View 2cqg on RCSB PDB site
Description: Solution structure of the RNA binding domain of TAR DNA-binding protein-43
Class: RNA Binding Protein
Keywords: RNA recognition motif, RRM, RNA binding domain, RBD, RNP, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA Binding Protein
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TAR DNA-binding protein-43
    Species: Homo sapiens [TaxId:9606]
    Gene: TARDBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13148 (7-96)
      • cloning artifact (0-6)
      • cloning artifact (97-102)
    Domains in SCOPe 2.06: d2cqga1, d2cqga2, d2cqga3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cqgA (A:)
gssgssgvkravqktsdlivlglpwktteqdlkeyfstfgevlmvqvkkdlktghskgfg
fvrfteyetqvkvmsqrhmidgrwcdcklpnskqsqdsgpssg