PDB entry 2cqe

View 2cqe on RCSB PDB site
Description: Solution Structure of the Zinc-finger domain in KIAA1064 protein
Class: transcription
Keywords: CCCH Zinc-finger, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, transcription
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: KIAA1064 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: C19orf7
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UPT8 (7-91)
    • cloning artifact (0-6)
    • cloning artifact (92-97)
  Domains in SCOPe 2.08: d2cqea1, d2cqea2, d2cqea3, d2cqea4
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cqeA (A:)
  gssgssgelpkkrelckfyitgfcaraencpymhgdfpcklyhttgncingddcmfshdp
  lteetrelldkmladdaeagaedekeveelkksgpssg