PDB entry 2cqd

View 2cqd on RCSB PDB site
Description: Solution Structure of the RNA recognition motif in RNA-binding region containing protein 1
Class: translation
Keywords: RNA recognition motif, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSLATION
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RNA-binding region containing protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: RNPC1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9H0Z9 (7-109)
    • cloning artifact (0-6)
    • cloning artifact (110-115)
  Domains in SCOPe 2.07: d2cqda1, d2cqda2, d2cqda3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cqdA (A:)
  gssgssgmhgsqkdttftkifvgglpyhttdaslrkyfegfgdieeavvitdrqtgksrg
  ygfvtmadraaaerackdpnpiidgrkanvnlaylgakprslqtgfaigvsgpssg