PDB entry 2cqb

View 2cqb on RCSB PDB site
Description: Solution Structure of the RNA recognition motif in Peptidyl-prolyl cis-trans isomerase E
Class: Isomerase
Keywords: RNA recognition motif, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Isomerase
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: peptidyl-prolyl cis-trans isomerase e
  Species: Homo sapiens [TaxId:9606]
  Gene: PPIE
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UNP9 (7-95)
    • cloning artifact (0-6)
    • cloning artifact (96-101)
  Domains in SCOPe 2.08: d2cqba1, d2cqba2, d2cqba3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cqbA (A:)
  gssgssgmattkrvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafve
  felaedaaaaidnmneselfgrtirvnlakpmrikesgpssg