PDB entry 2cqa

View 2cqa on RCSB PDB site
Description: Solution structure of RSGI RUH-039, a fragment of C-terminal domain of RuvB-like 2 from human cDNA
Class: Hydrolase
Keywords: RuvB like 2, TIP48, TIP49b, Reptin 52, ECP-51, TAP54-beta, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Hydrolase
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RuvB-like 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RUVBL2, TIP48, TIP49B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y230 (7-88)
      • cloning artifact (0-6)
      • cloning artifact (89-94)
    Domains in SCOPe 2.06: d2cqaa1, d2cqaa2, d2cqaa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cqaA (A:)
    gssgssgkeeteiiegevveiqidrpatgtgskvgkltlkttemetiydlgtkmiesltk
    dkvqagdvitidkatgkisklgrsftrarsgpssg