PDB entry 2cq2

View 2cq2 on RCSB PDB site
Description: solution structure of RNA binding domain in Hypothetical protein LOC91801
Class: RNA binding protein
Keywords: RRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein LOC91801
    Species: Homo sapiens [TaxId:9606]
    Gene: LOC9180
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N989 (7-107)
      • cloning artifact (0-6)
      • cloning artifact (108-113)
    Domains in SCOPe 2.08: d2cq2a1, d2cq2a2, d2cq2a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cq2A (A:)
gssgssgakhtllrhegietvsyatqslvvangglgngvsrnqllpvlekcglvdallmp
pnkpysfaryrtteeskrayvtlngkevvddlgqkitlylnfvekvqwsgpssg