PDB entry 2cq1

View 2cq1 on RCSB PDB site
Description: solution structure of RNA binding domain in PTB-like protein L
Class: transcription
Keywords: RRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: PTB-like protein L
  Species: Homo sapiens [TaxId:9606]
  Gene: PTBLP
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q969N9 (7-94)
    • cloning artifact (0-6)
    • cloning artifact (95-100)
  Domains in SCOPe 2.07: d2cq1a1, d2cq1a2, d2cq1a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cq1A (A:)
  gssgssgdkmdgapsrvlhirklpgevtetevialglpfgkvtnilmlkgknqaflelat
  eeaaitmvnyysavtphlrnqpiyiqysnhkelktsgpssg