PDB entry 2cpz

View 2cpz on RCSB PDB site
Description: solution structure of RNA binding domain 3 in CUG triplet repeat RNA-binding protein 1
Class: transcription
Keywords: RRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: CUG triplet repeat RNA-binding protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: CUGBP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q92879 (7-108)
    • cloning artifact (0-6)
    • cloning artifact (109-114)
  Domains in SCOPe 2.06: d2cpza1, d2cpza2, d2cpza3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cpzA (A:)
  gssgssgltqqsigaagsqkegpeganlfiyhlpqefgdqdllqmfmpfgnvvsakvfid
  kqtnlskcfgfvsydnpvsaqaaiqsmngfqigmkrlkvqlkrskndsksgpssg