PDB entry 2cpz

View 2cpz on RCSB PDB site
Description: solution structure of RNA binding domain 3 in CUG triplet repeat RNA-binding protein 1
Class: transcription
Keywords: RRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CUG triplet repeat RNA-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CUGBP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92879 (7-108)
      • cloning artifact (0-6)
      • cloning artifact (109-114)
    Domains in SCOPe 2.08: d2cpza1, d2cpza2, d2cpza3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cpzA (A:)
    gssgssgltqqsigaagsqkegpeganlfiyhlpqefgdqdllqmfmpfgnvvsakvfid
    kqtnlskcfgfvsydnpvsaqaaiqsmngfqigmkrlkvqlkrskndsksgpssg