PDB entry 2cpt

View 2cpt on RCSB PDB site
Description: Solution structure of MIT domain from human SKD1
Class: protein transport
Keywords: MIT, SKD1, helix bundle, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOP 1.75 freeze date was dated 2005-11-19, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vacuolar sorting protein 4b
    Species: HOMO SAPIENS
    Gene: VPS4B, SKD1, VPS42
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75351 (7-110)
      • cloning artifact (0-6)
      • cloning artifact (111-116)
    Domains in SCOP 1.75: d2cpta1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cptA (A:)
    gssgssgmsstspnlqkaidlaskaaqedkagnyeealqlyqhavqyflhvvkyeaqgdk
    akqsirakcteyldraeklkeylknkekkaqkpvkegqpspadekgndsdgsgpssg