PDB entry 2cpt

View 2cpt on RCSB PDB site
Description: Solution structure of MIT domain from human SKD1
Class: protein transport
Keywords: MIT, SKD1, helix bundle, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-19, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Vacuolar sorting protein 4b
  Species: HOMO SAPIENS
  Gene: VPS4B, SKD1, VPS42
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75351 (7-110)
    • cloning artifact (0-6)
    • cloning artifact (111-116)
  Domains in SCOP 1.73: d2cpta1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cptA (A:)
  gssgssgmsstspnlqkaidlaskaaqedkagnyeealqlyqhavqyflhvvkyeaqgdk
  akqsirakcteyldraeklkeylknkekkaqkpvkegqpspadekgndsdgsgpssg