PDB entry 2cpr

View 2cpr on RCSB PDB site
Description: Solution structure of the HRDC domain of human Exosome component 10
Class: gene regulation
Keywords: HRDC, helix-bundle, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exosome component 10
    Species: Homo sapiens [TaxId:9606]
    Gene: EXOSC10
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01780 (7-117)
      • cloning artifact (0-6)
      • cloning artifact (118-123)
    Domains in SCOPe 2.07: d2cpra1, d2cpra2, d2cpra3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cprA (A:)
    gssgssgkpiftdesylelyrkqkkhlntqqltafqllfawrdktarredesygyvlpnh
    mmlkiaeelpkepqgiiaccnpvpplvrqqinemhlliqqarempllksevaagvkkssg
    pssg